Human IL7 protein

Catalog Number: BYT-ORB594798
Article Name: Human IL7 protein
Biozol Catalog Number: BYT-ORB594798
Supplier Catalog Number: orb594798
Alternative Catalog Number: BYT-ORB594798-10,BYT-ORB594798-50,BYT-ORB594798-500,BYT-ORB594798-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-7, IL-7, IL7
This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 17.5 kDa
UniProt: P13232
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 250 mM NaCl, pH 7.2
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL