Human IL6 protein

Catalog Number: BYT-ORB594784
Article Name: Human IL6 protein
Biozol Catalog Number: BYT-ORB594784
Supplier Catalog Number: orb594784
Alternative Catalog Number: BYT-ORB594784-10,BYT-ORB594784-50,BYT-ORB594784-500,BYT-ORB594784-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-6, IL-6, B-Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon Beta-2, IFN-Beta-2, IL6, IFNB2
This Human IL6 protein spans the amino acid sequence from region 30-212aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 20.9 kDa
UniProt: P05231
Buffer: Lyophilized from a 0.2 µm filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 20-100 pg/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL