Human IFN gamma protein

Catalog Number: BYT-ORB594774
Article Name: Human IFN gamma protein
Biozol Catalog Number: BYT-ORB594774
Supplier Catalog Number: orb594774
Alternative Catalog Number: BYT-ORB594774-10,BYT-ORB594774-50,BYT-ORB594774-500,BYT-ORB594774-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG
This Human IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 16.88 kDa
UniProt: P01579
Buffer: Lyophilized from a 0.2 µm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by a cytotoxicity assay using HT-29 cells is 17 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL