Human THPO protein

Catalog Number: BYT-ORB594751
Article Name: Human THPO protein
Biozol Catalog Number: BYT-ORB594751
Supplier Catalog Number: orb594751
Alternative Catalog Number: BYT-ORB594751-10,BYT-ORB594751-50,BYT-ORB594751-500,BYT-ORB594751-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thrombopoietin,C-mpl ligand,Megakaryocyte colony-stimulating factor,Megakaryocyte growth and development factor,Myeloproliferative leukemia virus oncogene ligand,THPO
This Human THPO protein spans the amino acid sequence from region 22-353aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 37.3 kDa
UniProt: P40225
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL