Mouse Csf1 protein

Catalog Number: BYT-ORB594718
Article Name: Mouse Csf1 protein
Biozol Catalog Number: BYT-ORB594718
Supplier Catalog Number: orb594718
Alternative Catalog Number: BYT-ORB594718-10,BYT-ORB594718-50,BYT-ORB594718-500,BYT-ORB594718-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Macrophage colony-stimulating factor 1,CSF-1,MCSF,Csf1,Csfm
This Mouse Csf1 protein spans the amino acid sequence from region 33-262aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 26 kDa
UniProt: P07141
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells is 0.04-0.2 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.