HTR2C Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB592794
- Images (7)
| Article Name: | HTR2C Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB592794 |
| Supplier Catalog Number: | orb592794 |
| Alternative Catalog Number: | BYT-ORB592794-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2C |
| Conjugation: | Unconjugated |
| Alternative Names: | HTR1C, 5-HT1C, 5-HT2C, 5HTR2C, 5-HTR2C |
| Rabbit polyclonal antibody to HTR2C |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 52kDa |
| NCBI: | 000859 |
| UniProt: | P28335 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA |
| Target: | HTR2C |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-HTR2C Antibody Titration: 5.0 ug/ml, Positive Control: A: Daudi cell lysate, B: Raji cell lysate. |
Product Guarantee and Expert Support
