Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
Target:
TNFRSF1A
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein is processed to ~48 kDa, a smaller isoform of 24 kDa also contains the peptide sequence, and the protein may also be glycosylated.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): THP-1 (N30), Negative control (-): SH-SY5Y (N19), Antibody concentration: 1 ug/ml.
Immunofluorescent TNFRSF1A detection in human lymphocytes (green fluorescence). Nuclei were stained with DAPI (blue fluorescence), Working dilution 5-10 ug/ml.
WB Suggested Anti-TNFRSF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: DU145 cell lysate. TNFRSF1A is supported by BioGPS gene expression data to be expressed in DU145.
* VAT and and shipping costs not included. Errors and price changes excepted