Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH
Target:
NME1
Anti-NME1 antibody IHC of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.
Anti-NME1 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Primary Antibody concentration 5 ug/ml.
DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.
Human kidney
Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.
Lanes: 1. 20 ug murine 4T1 primary breast tumor cell lysate, 2. 20 ug human MDA-MB-231 cell lysate, 3. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: NME1.
NME1 antibody - N-terminal region (orb592639) validated by WB using Fetal Heart Lysate at 1 ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted
