FAM108A1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB586821
- Images (6)
| Article Name: | FAM108A1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB586821 |
| Supplier Catalog Number: | orb586821 |
| Alternative Catalog Number: | BYT-ORB586821-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1 |
| Conjugation: | Unconjugated |
| Alternative Names: | C19orf27, FAM108A1 |
| Rabbit polyclonal antibody to FAM108A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 39kDa |
| NCBI: | 112490 |
| UniProt: | H2R6I8 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI |
| Target: | ABHD17A |
|
|
Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. ABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. ABHD17A is supported by BioGPS gene expression data to be expressed in Jurkat. |
Product Guarantee and Expert Support
