RPL15 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB586169
- Images (6)
| Article Name: | RPL15 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB586169 |
| Supplier Catalog Number: | orb586169 |
| Alternative Catalog Number: | BYT-ORB586169-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Conjugation: | Unconjugated |
| Alternative Names: | L15, EC45, DBA12, RPL10, RPLY10, RPYL10 |
| Rabbit polyclonal antibody to RPL15 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 24 kDa |
| NCBI: | 002939 |
| UniProt: | P61313 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK |
| Target: | RPL15 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
WB Suggested Anti-RPL15 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. |
Product Guarantee and Expert Support
