Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
Target:
TSTA3
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human ACHN Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Rabbit Anti-TSTA3 Antibody, Catalog Number: orb584081, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-TSTA3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. TSTA3 is supported by BioGPS gene expression data to be expressed in MCF7.
* VAT and and shipping costs not included. Errors and price changes excepted
