BECN1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB584053
| Article Name: |
BECN1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB584053 |
| Supplier Catalog Number: |
orb584053 |
| Alternative Catalog Number: |
BYT-ORB584053-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human BECN1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ATG6, VPS30, beclin1 |
| Rabbit polyclonal antibody to Beclin 1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
50kDa |
| NCBI: |
003757 |
| UniProt: |
Q14457 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL |
| Target: |
BECN1 |
![]()
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
![]()
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
![]()
|
Rabbit Anti-BECN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-BECN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-BECN1 Antibody, Catalog Number: orb584053, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-BECN1 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. |
