Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Target:
CPE
Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. CPE is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-CPE antibody (orb583996).
Rabbit Anti-CPE Antibody, Catalog Number: orb583996, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. CPE is supported by BioGPS gene expression data to be expressed in MCF7.
* VAT and and shipping costs not included. Errors and price changes excepted
