Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM
Target:
FOXA1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
FOXA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb583752 with 1:200 dilution. Western blot was performed using orb583752 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: FOXA1 IP with orb583752 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2.
