SELENBP1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580344
| Article Name: |
SELENBP1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB580344 |
| Supplier Catalog Number: |
orb580344 |
| Alternative Catalog Number: |
BYT-ORB580344-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SELENBP1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
MTO, LPSB, SP56, hSBP, EHMTO, SBP56, HEL-S-134P |
| Rabbit polyclonal antibody to SELENBP1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
44kDa |
| NCBI: |
32997 |
| UniProt: |
Q13228 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR |
| Target: |
SELENBP1 |
![]()
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
![]()
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7. |
![]()
|
Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml. |
![]()
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
![]()
|
Rabbit Anti-SELENBP1 Antibody, Catalog Number: orb580344, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic, membrane and nuclear in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-SELENBP1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. |
