EEF1A2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580330
- Images (6)
| Article Name: | EEF1A2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580330 |
| Supplier Catalog Number: | orb580330 |
| Alternative Catalog Number: | BYT-ORB580330-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2 |
| Conjugation: | Unconjugated |
| Alternative Names: | HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33, EF-1-alpha-2 |
| Rabbit polyclonal antibody to EEF1A2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 50 kDa |
| NCBI: | 001949 |
| UniProt: | Q05639 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP |
| Target: | EEF1A2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation, acteylation, phosphorylation and/or lipidation. |
|
|
Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-EEF1A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain. |
|
|
WB Suggested Anti-EEF1A2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2. |
Product Guarantee and Expert Support
