ATP5F1B Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580321
- Images (6)
| Article Name: | ATP5F1B Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580321 |
| Supplier Catalog Number: | orb580321 |
| Alternative Catalog Number: | BYT-ORB580321-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B |
| Conjugation: | Unconjugated |
| Alternative Names: | ATP5B, ATPMB, ATPSB, HEL-S-271 |
| Rabbit polyclonal antibody to ATP5F1B |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 57 kDa |
| NCBI: | 001677 |
| UniProt: | P06576 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ |
| Target: | ATP5F1B |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/ml of the antibody was used in this experiment. |
|
|
ATP5B antibody - N-terminal region (orb580321) validated by WB using HepG2 cell lysate at 1.25 ug/ml. |
|
|
ATP5B antibody - N-terminal region (orb580321) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000. |
|
|
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml. |
|
|
Human Muscle |
Product Guarantee and Expert Support
