Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
Target:
APEH
APEH was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb580319 with 1:200 dilution. Western blot was performed using orb580319 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: APEH IP with orb580319 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-APEH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. APEH is supported by BioGPS gene expression data to be expressed in 721_B.
