HSP90AA1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB573596
Article Name: HSP90AA1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB573596
Supplier Catalog Number: orb573596
Alternative Catalog Number: BYT-ORB573596-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1
Conjugation: Unconjugated
Alternative Names: EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p
Rabbit polyclonal antibody to HSP90AA1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 98kDa
NCBI: 001017963
UniProt: P07900
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN
Target: HSP90AA1
Anti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-HSP90AA1 / Hsp90 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
Rabbit Anti-HSP90AA1 Antibody, Catalog Number: orb573596, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-HSP90AA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, HSP90AA1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.