Human LAG3 protein

Catalog Number: BYT-ORB54067
Article Name: Human LAG3 protein
Biozol Catalog Number: BYT-ORB54067
Supplier Catalog Number: orb54067
Alternative Catalog Number: BYT-ORB54067-20,BYT-ORB54067-100,BYT-ORB54067-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein FDC, CD223
This Human LAG3 protein spans the amino acid sequence from region 29-450aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 75.6 kDa
UniProt: P18627
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-GST-tagged2-564AA: 29-450AAFull Length: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAG3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LAG3.