Human IL 1 alpha Protein

Catalog Number: BYT-ORB429395
Article Name: Human IL 1 alpha Protein
Biozol Catalog Number: BYT-ORB429395
Supplier Catalog Number: orb429395
Alternative Catalog Number: BYT-ORB429395-1,BYT-ORB429395-10,BYT-ORB429395-2
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.
Recombinant of human IL1 alpha protein
Buffer: The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8.
Purity: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA
Application Notes: Solubility: It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg. Application Notes: Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 1.13 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1 as a Reference Standard