Human VEGFC (HEK) Protein

Catalog Number: BYT-ORB429198
Article Name: Human VEGFC (HEK) Protein
Biozol Catalog Number: BYT-ORB429198
Supplier Catalog Number: orb429198
Alternative Catalog Number: BYT-ORB429198-1,BYT-ORB429198-20,BYT-ORB429198-5
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L, Vascular endothelial growth factor-related protein, VEGFC.
Recombinant of human VEGFC (HEK) protein
Buffer: VEGFC was lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH
Application Notes: Solubility: It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Cytokines And Growth Factors