Human VCAM1 (HEK) Protein

Catalog Number: BYT-ORB429173
Article Name: Human VCAM1 (HEK) Protein
Biozol Catalog Number: BYT-ORB429173
Supplier Catalog Number: orb429173
Alternative Catalog Number: BYT-ORB429173-1,BYT-ORB429173-10,BYT-ORB429173-50
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333.
Recombinant of human VCAM1 (HEK) protein
Buffer: VCAM1 was lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2.
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI
Application Notes: Solubility: It is recommended to reconstitute the lyophilized VCAM1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Recombinant & Natural Proteins