Human Protease protein
Catalog Number:
BYT-ORB419333
- Images (3)
| Article Name: | Human Protease protein |
| Biozol Catalog Number: | BYT-ORB419333 |
| Supplier Catalog Number: | orb419333 |
| Alternative Catalog Number: | BYT-ORB419333-20,BYT-ORB419333-100,BYT-ORB419333-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Adenain Adenovirus protease |
| This Human Protease protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 28.1 kDa |
| UniProt: | P03253 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM |
| Application Notes: | Biological Origin: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-204aaSequence Info: Full Length |



