Viral Glycoprotein protein

Catalog Number: BYT-ORB419329
Article Name: Viral Glycoprotein protein
Biozol Catalog Number: BYT-ORB419329
Supplier Catalog Number: orb419329
Alternative Catalog Number: BYT-ORB419329-20,BYT-ORB419329-100,BYT-ORB419329-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GGlycoprotein
This Viral Glycoprotein protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 69.7 kDa
UniProt: O92284
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rabies virus (strain CVS-11) (RABV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD
Application Notes: Biological Origin: Rabies virus (strain CVS-11) (RABV). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 20-459aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain CVS-11) (RABV) G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain CVS-11) (RABV) G.