Mouse ADAM12 protein
Catalog Number:
BYT-ORB419288
- Images (3)
| Article Name: | Mouse ADAM12 protein |
| Biozol Catalog Number: | BYT-ORB419288 |
| Supplier Catalog Number: | orb419288 |
| Alternative Catalog Number: | BYT-ORB419288-20,BYT-ORB419288-100,BYT-ORB419288-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Meltrin-alpha |
| This Mouse ADAM12 protein spans the amino acid sequence from region 206-706aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 58.4 kDa |
| UniProt: | Q61824 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDA |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 206-706aaSequence Info: Full Length of Mature Protein |



