E. coli PHRB protein

Catalog Number: BYT-ORB419092
Article Name: E. coli PHRB protein
Biozol Catalog Number: BYT-ORB419092
Supplier Catalog Number: orb419092
Alternative Catalog Number: BYT-ORB419092-20,BYT-ORB419092-100,BYT-ORB419092-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DNA photolyase Photoreactivating enzyme
This E. coli PHRB protein spans the amino acid sequence from region 1-472aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 73.7 kDa
UniProt: P00914
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTTHLVWFRQDLRLHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKVRSSGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLATGGLSPRQCLHR
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-472aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) phrB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) phrB.