Bacterial HRP1 protein

Catalog Number: BYT-ORB418912
Article Name: Bacterial HRP1 protein
Biozol Catalog Number: BYT-ORB418912
Supplier Catalog Number: orb418912
Alternative Catalog Number: BYT-ORB418912-1,BYT-ORB418912-100,BYT-ORB418912-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: hrp1, Rv2626cHypoxic response protein 1, HRP1
This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 35.5 kDa
UniProt: P9WJA3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Application Notes: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.