Human CHID1 protein

Catalog Number: BYT-ORB358844
Article Name: Human CHID1 protein
Biozol Catalog Number: BYT-ORB358844
Supplier Catalog Number: orb358844
Alternative Catalog Number: BYT-ORB358844-20,BYT-ORB358844-100,BYT-ORB358844-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Stabilin-1-interacting chitinase-like protein Short name, SI-CLP
This Human CHID1 protein spans the amino acid sequence from region 20-393aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.8 kDa
UniProt: Q9BWS9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKHAKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLTHLAEALHQARLLALLVIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.