Dog CSF3 protein

Catalog Number: BYT-ORB358843
Article Name: Dog CSF3 protein
Biozol Catalog Number: BYT-ORB358843
Supplier Catalog Number: orb358843
Alternative Catalog Number: BYT-ORB358843-20,BYT-ORB358843-100,BYT-ORB358843-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, G-CSF
This Dog CSF3 protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.9 kDa
UniProt: P35834
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPLGPTGPLPQSFLLKCLEQMRKVQADGTALQETLCATHQLCHPEELVLLGHALGIPQPPLSSCSSQALQLMGCLRQLHSGLFLYQGLLQALAGISPELAPTLDTLQLDTTDFAINIWQQMEDLGMAPAVPPTQGTMPAFTSAFQRRAGGVLVASNLQSFLELAYRALRHFAKP
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.