Rat C1qa protein

Catalog Number: BYT-ORB358838
Article Name: Rat C1qa protein
Biozol Catalog Number: BYT-ORB358838
Supplier Catalog Number: orb358838
Alternative Catalog Number: BYT-ORB358838-20,BYT-ORB358838-100,BYT-ORB358838-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C1qa, Complement C1q subcomponent subunit A
This Rat C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 39.6 kDa
UniProt: P31720
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.