Animal JTB protein

Catalog Number: BYT-ORB358835
Article Name: Animal JTB protein
Biozol Catalog Number: BYT-ORB358835
Supplier Catalog Number: orb358835
Alternative Catalog Number: BYT-ORB358835-20,BYT-ORB358835-100,BYT-ORB358835-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: JTB, Protein JTB
This Animal JTB protein spans the amino acid sequence from region 31-105aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.4 kDa
UniProt: O77049
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Brugia malayi (Filarial nematode worm)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL
Application Notes: Biological Origin: Brugia malayi (Filarial nematode worm). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.