Bacterial Putative N-acetylmuramoyl-L-alanine amidase RC0497 protein

Catalog Number: BYT-ORB358829
Article Name: Bacterial Putative N-acetylmuramoyl-L-alanine amidase RC0497 protein
Biozol Catalog Number: BYT-ORB358829
Supplier Catalog Number: orb358829
Alternative Catalog Number: BYT-ORB358829-20,BYT-ORB358829-100,BYT-ORB358829-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: RC0497, Putative N-acetylmuramoyl-L-alanine amidase RC0497, EC 3.5.1.28
This Bacterial Putative N-acetylmuramoyl-L-alanine amidase RC0497 protein spans the amino acid sequence from region 1-267aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.6 kDa
UniProt: Q92IC3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQL
Application Notes: Biological Origin: Rickettsia conorii (strain ATCC VR-613 / Malish 7). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.