Bacterial rnfH protein

Catalog Number: BYT-ORB358828
Article Name: Bacterial rnfH protein
Biozol Catalog Number: BYT-ORB358828
Supplier Catalog Number: orb358828
Alternative Catalog Number: BYT-ORB358828-20,BYT-ORB358828-100,BYT-ORB358828-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rnfH, CbuG_0706, Protein RnfH
This Bacterial rnfH protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.3 kDa
UniProt: B6IZH9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212))
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG
Application Notes: Biological Origin: Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212)). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.