Bacterial clpP protein

Catalog Number: BYT-ORB358827
Article Name: Bacterial clpP protein
Biozol Catalog Number: BYT-ORB358827
Supplier Catalog Number: orb358827
Alternative Catalog Number: BYT-ORB358827-20,BYT-ORB358827-100,BYT-ORB358827-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Endopeptidase Clp
This Bacterial clpP protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37.5 kDa
UniProt: A5I6W1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Application Notes: Biological Origin: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.