Plant Non-specific lipid-transfer protein protein

Catalog Number: BYT-ORB358811
Article Name: Plant Non-specific lipid-transfer protein protein
Biozol Catalog Number: BYT-ORB358811
Supplier Catalog Number: orb358811
Alternative Catalog Number: BYT-ORB358811-20,BYT-ORB358811-100,BYT-ORB358811-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Phospholipid transfer protein Short name, PLTP
This Plant Non-specific lipid-transfer protein protein spans the amino acid sequence from region 25-113aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 25.5 kDa
UniProt: P24296
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Triticum aestivum (Wheat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV
Application Notes: Biological Origin: Triticum aestivum (Wheat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.