Mouse CHLP protein

Catalog Number: BYT-ORB358808
Article Name: Mouse CHLP protein
Biozol Catalog Number: BYT-ORB358808
Supplier Catalog Number: orb358808
Alternative Catalog Number: BYT-ORB358808-20,BYT-ORB358808-100,BYT-ORB358808-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Geranylgeranyl reductase
This Mouse CHLP protein spans the amino acid sequence from region 44-467aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 63.1 kDa
UniProt: Q9CA67
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AARATPKLSNRKLRVAVIGGGPAGGAAAETLAQGGIETILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLDAYLRERAEKSGATVINGLFLKMDHPENWDSPYTLHYTEYDGKTGATGTKKTMEVDAVIGADGANSRVAKSIDAGDYDYAIAFQERIRIPDEKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRA
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.