Viral HA protein

Catalog Number: BYT-ORB358803
Article Name: Viral HA protein
Biozol Catalog Number: BYT-ORB358803
Supplier Catalog Number: orb358803
Alternative Catalog Number: BYT-ORB358803-20,BYT-ORB358803-100,BYT-ORB358803-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cleaved into the following 2 chains, Hemagglutinin HA1 chain Hemagglutinin HA2 chain
This Viral HA protein spans the amino acid sequence from region 18-343aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52.6 kDa
UniProt: Q0HD60
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Influenza A virus (strain A/Hickox/1940 H1N1)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGKCNIAGWILGNPECESLLSKRSWSYIAETPNSENGTCYPGDFADYEELREQLSSVSSFERFEIFPKERSWPNHNINIGVTAACSHAGKSSFYKNLLWLTEKDGSYPNLNKSYVNKKEKEVLVLWGVHHPSNIENQKTLYRKENAYVSVVSSNYNRRFTPEIAERPKVRGQAGRMNYYWTLLEPGDTIIFEANGNLIAPWYAF
Application Notes: Biological Origin: Influenza A virus (strain A/Hickox/1940 H1N1). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.