Plant ypr-10 protein

Catalog Number: BYT-ORB358792
Article Name: Plant ypr-10 protein
Biozol Catalog Number: BYT-ORB358792
Supplier Catalog Number: orb358792
Alternative Catalog Number: BYT-ORB358792-20,BYT-ORB358792-100,BYT-ORB358792-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Plant ypr-10 protein spans the amino acid sequence from region 1-157aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32.9 kDa
UniProt: D1YSM5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Actinidia deliciosa (Kiwi)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC
Application Notes: Biological Origin: Actinidia deliciosa (Kiwi). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.