Rat Tdo2 protein

Catalog Number: BYT-ORB358786
Article Name: Rat Tdo2 protein
Biozol Catalog Number: BYT-ORB358786
Supplier Catalog Number: orb358786
Alternative Catalog Number: BYT-ORB358786-20,BYT-ORB358786-100,BYT-ORB358786-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tryptamin 2,3-dioxygenase Tryptophan oxygenase Tryptophan pyrrolase Tryptophanase
This Rat Tdo2 protein spans the amino acid sequence from region 1-406aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 63.9 kDa
UniProt: P21643
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSGCPFSGNSVGYTLKNLSMEDNEEDGAQTGVNRASKGGLIYGDYLQLEKILNAQELQSEIKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVMTRMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFEGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPHGFNFWGKFEKNILKGLEEEFLKIQAKKDSEEKEEQMA
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.