Human TSLP protein

Catalog Number: BYT-ORB358785
Article Name: Human TSLP protein
Biozol Catalog Number: BYT-ORB358785
Supplier Catalog Number: orb358785
Alternative Catalog Number: BYT-ORB358785-20,BYT-ORB358785-100,BYT-ORB358785-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN
This Human TSLP protein spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.9 kDa
UniProt: Q969D9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.