Viral VACWR034 protein

Catalog Number: BYT-ORB358765
Article Name: Viral VACWR034 protein
Biozol Catalog Number: BYT-ORB358765
Supplier Catalog Number: orb358765
Alternative Catalog Number: BYT-ORB358765-20,BYT-ORB358765-100,BYT-ORB358765-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein K2
This Viral VACWR034 protein spans the amino acid sequence from region 1-88aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 12.6 kDa
UniProt: P18378
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Application Notes: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.