Human Mast Cell Chymase protein

Catalog Number: BYT-ORB358760
Article Name: Human Mast Cell Chymase protein
Biozol Catalog Number: BYT-ORB358760
Supplier Catalog Number: orb358760
Alternative Catalog Number: BYT-ORB358760-20,BYT-ORB358760-100,BYT-ORB358760-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein
This Human Mast Cell Chymase protein spans the amino acid sequence from region 22-247aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29 kDa
UniProt: P23946
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.