Bacterial Rubredoxin protein

Catalog Number: BYT-ORB358758
Article Name: Bacterial Rubredoxin protein
Biozol Catalog Number: BYT-ORB358758
Supplier Catalog Number: orb358758
Alternative Catalog Number: BYT-ORB358758-20,BYT-ORB358758-100,BYT-ORB358758-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, Rd
This Bacterial Rubredoxin protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22 kDa
UniProt: P00268
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Clostridium pasteurianum
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Application Notes: Biological Origin: Clostridium pasteurianum. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.