Bacterial pat protein

Catalog Number: BYT-ORB358755
Article Name: Bacterial pat protein
Biozol Catalog Number: BYT-ORB358755
Supplier Catalog Number: orb358755
Alternative Catalog Number: BYT-ORB358755-20,BYT-ORB358755-100,BYT-ORB358755-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Phosphinothricin-resistance protein
This Bacterial pat protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.6 kDa
UniProt: Q57146
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptomyces viridochromogenes
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI
Application Notes: Biological Origin: Streptomyces viridochromogenes. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.