Fungi SAP9 protein

Catalog Number: BYT-ORB358753
Article Name: Fungi SAP9 protein
Biozol Catalog Number: BYT-ORB358753
Supplier Catalog Number: orb358753
Alternative Catalog Number: BYT-ORB358753-20,BYT-ORB358753-100,BYT-ORB358753-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ACP 9 Aspartate protease 9 Secreted aspartic protease 9
This Fungi SAP9 protein spans the amino acid sequence from region 18-544aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.9 kDa
UniProt: O42779
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Candida albicans (Yeast)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AKAPFKIDFEVRRGESKDDLSPEDDSNPRFVKRDGSLDMTLTNKQTFYMATLKIGSNEDENRVLEDTGSSDLWVMSHDLKCVSAPISKRNERSFGHGTGVKLNERELMQKRKNLYQPSRTIETDEEKEASEKIHNKLFGFGSIYSTVYITEGPGAYSTFSPLVGTEGGSGGSGGSNTCRSYGSFNTENSDTFKKNNTNDFEIQYADDTSAIGIWGYDDVTISNVTVKDLSFAIANETSSDVGVLGIGLPGLEVTT
Application Notes: Biological Origin: Candida albicans (Yeast). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.