Insect Allergen Bla g 4 protein

Catalog Number: BYT-ORB358748
Article Name: Insect Allergen Bla g 4 protein
Biozol Catalog Number: BYT-ORB358748
Supplier Catalog Number: orb358748
Alternative Catalog Number: BYT-ORB358748-20,BYT-ORB358748-100,BYT-ORB358748-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Bla g IV Allergen, Bla g 4
This Insect Allergen Bla g 4 protein spans the amino acid sequence from region 13-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 21.8 kDa
UniProt: P54962
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Blattella germanica (German cockroach) (Blatta germanica)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH
Application Notes: Biological Origin: Blattella germanica (German cockroach) (Blatta germanica). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.