Human TUBB4A protein

Catalog Number: BYT-ORB358747
Article Name: Human TUBB4A protein
Biozol Catalog Number: BYT-ORB358747
Supplier Catalog Number: orb358747
Alternative Catalog Number: BYT-ORB358747-20,BYT-ORB358747-100,BYT-ORB358747-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tubulin 5 beta Tubulin beta-4 chain
This Human TUBB4A protein spans the amino acid sequence from region 1-444aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.6 kDa
UniProt: P04350
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.