Rat Lum protein

Catalog Number: BYT-ORB358738
Article Name: Rat Lum protein
Biozol Catalog Number: BYT-ORB358738
Supplier Catalog Number: orb358738
Alternative Catalog Number: BYT-ORB358738-20,BYT-ORB358738-100,BYT-ORB358738-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Keratan sulfate proteoglycan lumican Short name, KSPG lumican
This Rat Lum protein spans the amino acid sequence from region 19-338aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 40.5 kDa
UniProt: P51886
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVN
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.