Human ACKR3 protein

Catalog Number: BYT-ORB358729
Article Name: Human ACKR3 protein
Biozol Catalog Number: BYT-ORB358729
Supplier Catalog Number: orb358729
Alternative Catalog Number: BYT-ORB358729-20,BYT-ORB358729-100,BYT-ORB358729-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C-X-C chemokine receptor type 7 Short name, CXC-R7 Short name, CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name, RDC-1
This Human ACKR3 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 20.5 kDa
UniProt: P25106
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.